Specifications
- CAS number
- 77591-33-4
- Formula
- C212H350N56O78S
- Molecular weight
- 4963.44 g/mol
- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
- Purity (minimum)
- ≥ 98%
- Form
- Lyophilised powder
- Storage
- Refrigerated, 2 to 8 °C
Before you continue
This site sells research compounds for laboratory use. By continuing you confirm that you are 18 or older and that any purchase is for in vitro research, not for human or animal use.